Customization: | Available |
---|---|
Application: | Construction |
Bonding Function: | Structural Adhesive |
Still deciding? Get samples of $ !
Order Sample
|
Shipping Cost: | Contact the supplier about freight and estimated delivery time. |
---|
Payment Methods: |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
---|---|
Support payments in USD |
Secure payments: | Every payment you make on Made-in-China.com is protected by the platform. |
---|
Refund policy: | Claim a refund if your order doesn't ship, is missing, or arrives with product issues. |
---|
Suppliers with verified business licenses
Audited by an independent third-party inspection agency
Our premium silicone sealant is specifically designed forinsulatingglassapplications. ManufacturedbyRT -7500, this cutting-edge sealantconformsto the renownedISR-20HM-JC/T 486-2001 standards.
It is neutral cured, ensuring no corrosion andnonpoisonous properties.This revolutionary sealant is expertly crafted tocreate an incredibly strong and lasting secondary seal inadualsealedinsulatingglassunit.unit, ensuring unparalleled durability and superior performance.
Theexceptionalperformancefeatures preciselyintegratedintothiscutting-edgesealantmakeitperfectly ideal and highlysuitable for a range ofapplications:
Seq. No | Test items | Technical parameters | Test results | |
1 | Appearance | Smooth, uniform paste or viscous substance. There should be no bubbles, skin formation, or gelation. The colors of the components should be distinctly different |
Smooth, uniform paste, without bubbles, skin formation, or gelation. The colors of the components should be distinctly different | |
2 | Density /(g/cm) | A Component | Specified value ±0.1 (1.50 ±0.1) | 1.51 |
B Component | Specified value ±0.1 (1.00 ±0.1) | 1.01 | ||
3 | Sag | vertical / mm | ≤3 | 0 |
horizontal | No deformation | No deformation | ||
4 | Skinning time / h | ≤2 | 1 | |
5 | Service life/min | ≥20 | 82 | |
6 | Hardness/Shore A | 30~60 | 49 | |
7 | Elastic recovery rate / % | ≥80 | 91 | |
8 | Tensile adhesive strength | Tensile adhesive strength /MPa | ≥0.60 | 0.83 |
Elongation at maximum tensile strength / % | ≥50 | 62 | ||
Adhesive failure area / % | ≤10 | 0 | ||
Note | 1,Substrate cleaning solution: 50% is opropanol aqueous solution. | |||
2,Sample preparation ratio: A:B= 15:1 (W/W). | ||||
3,Test substrate: Float glass. | ||||
4,Density specified value provided by the manufacturer. |
Q1: Are you manufacturer?
A1: Yes, we are manufacturer. We have 2 factories which around 50,000 square meters, our production capacity is over 30000 tons per year, on time delivery is supported.
Q2: Do you provide OEM/ private label service?
A2: Yes, We offer OEM/private label services. Additionally, we provide free design and small MOQ for private label sealants.
Q3: What other products do you have?
A3: Runtai serves one stop solution of sealants & adhesives, including: PU Foam, Silicone Sealant, Acrylic Sealant, PU Sealant, MS Sealant, Spray Paint, Water Based Adhesive, Zero Nail Construction Adhesive, Marble Glue & Epoxy Resin.
Q4: Why do we choose you?
A4: With 2 factories which are around 50,000 square meters,Runtai is called one of the biggest manufacturers in China. Our products are fully comply with American & European standards. We supply to fortune TOP 500 enterprises in more than 50 countries, which is the Top10 customized Export Volume in China.
Q5: Can I get a free sample?
A5: We offer free samples for clients. Please feel free to contact us for more details , we can recommend the suitable samples according to your requirement.
Q6: What is benefit to be your distributors?
1. We support our distributor to become stronger.
2. We provide technical Know-How on selling.
3. We train our distributor's sales team.
4. We train our distributor's dealers.
5. We support you to become better.